Lineage for d5h2uc1 (5h2u C:185-446)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (842 PDB entries)
  8. 2284530Domain d5h2uc1: 5h2u C:185-446 [327831]
    Other proteins in same PDB: d5h2ua2, d5h2ua3, d5h2ub2, d5h2ub3, d5h2uc2, d5h2uc3, d5h2ud2, d5h2ud3
    automated match to d3clya_
    complexed with 1n1, gol

Details for d5h2uc1

PDB Entry: 5h2u (more details), 2.24 Å

PDB Description: crystal structure of ptk6 kinase domain complexed with dasatinib
PDB Compounds: (C:) Protein-tyrosine kinase 6

SCOPe Domain Sequences for d5h2uc1:

Sequence, based on SEQRES records: (download)

>d5h2uc1 d.144.1.0 (C:185-446) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erpreeftlcrklgsgyfgevfeglwkdrvqvaikvisrdnllhqqmlqseiqamkklrh
khilalyavvsvgdpvyiitelmakgsllellrdsdekvlpvselldiawqvaegmcyle
sqnyihrdlaarnilvgentlckvgdfglarlikedvylshdhnipykwtapealsrghy
stksdvwsfgillhemfsrgqvpypgmsnheaflrvdagyrmpcplecppsvhklmltcw
crdpeqrptfkalrerlssfts

Sequence, based on observed residues (ATOM records): (download)

>d5h2uc1 d.144.1.0 (C:185-446) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erpreeftlcrklgsgyfgevfeglwkdrvqvaikvisrdnllhqqmlqseiqamkklrh
khilalyavvsvgdpvyiitelmakgsllellrsdekvlpvselldiawqvaegmcyles
qnyihrdlaarnilvgentlckvgdfglarlikedvylshdhnipykwtapealsrghys
tksdvwsfgillhemfsrgqvpypgmsnheaflrvdagyrmpcplecppsvhklmltcwc
rdpeqrptfkalrerlssfts

SCOPe Domain Coordinates for d5h2uc1:

Click to download the PDB-style file with coordinates for d5h2uc1.
(The format of our PDB-style files is described here.)

Timeline for d5h2uc1:

  • d5h2uc1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-04