Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (10 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [237857] (3 PDB entries) |
Domain d5tpxa1: 5tpx A:1356-1460 [327826] Other proteins in same PDB: d5tpxa2 automated match to d4ldfa_ complexed with 7h7, cl, so4 |
PDB Entry: 5tpx (more details), 2.1 Å
SCOPe Domain Sequences for d5tpxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tpxa1 a.29.2.0 (A:1356-1460) automated matches {Plasmodium falciparum [TaxId: 36329]} hkevqlkdqilgvldylekqqsawpflkpvslseapdyydiikeptdiltmrrkarhgdy ktkedfgielkrmfdncrlynapttiyfkyanelqtliwpkyeai
Timeline for d5tpxa1: