SCOPe 2.06: Domain d5tpxa1: 5tpx A:1356-1460

Lineage for d5tpxa1 (5tpx A:1356-1460)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (10 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [237857] (3 PDB entries)

8. Domain d5tpxa1: 5tpx A:1356-1460 [327826]
   Other proteins in same PDB: d5tpxa2
   automated match to d4ldfa_
   complexed with 7h7, cl, so4

Details for d5tpxa1

PDB Entry: 5tpx, 2.1 Å

PDB Description: bromodomain from plasmodium faciparum gcn5, complexed with compound

PDB Compounds: (A:) histone acetyltransferase gcn5

SCOPe Domain Sequences for d5tpxa1:

Sequence; same for both SEQRES and ATOM records:

>d5tpxa1 a.29.2.0 (A:1356-1460) automated matches {Plasmodium falciparum [TaxId: 36329]}
hkevqlkdqilgvldylekqqsawpflkpvslseapdyydiikeptdiltmrrkarhgdy
ktkedfgielkrmfdncrlynapttiyfkyanelqtliwpkyeai

Timeline for d5tpxa1:

• d5tpxa1 is new in SCOPe 2.06-stable
  
• d5tpxa1 appears in SCOPe 2.07
  
• d5tpxa1 appears in the current release, SCOPe 2.08