SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tpxa1 (5tpx A:1356-1460)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992467Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1992468Protein automated matches [190615] (10 species)
    not a true protein
  7. 1992870Species Plasmodium falciparum [TaxId:36329] [237857] (3 PDB entries)
  8. 2284525Domain d5tpxa1: 5tpx A:1356-1460 [327826]
    Other proteins in same PDB: d5tpxa2
    automated match to d4ldfa_
    complexed with 7h7, cl, so4

Details for d5tpxa1

PDB Entry: 5tpx (more details), 2.1 Å

PDB Description: bromodomain from plasmodium faciparum gcn5, complexed with compound
PDB Compounds: (A:) histone acetyltransferase gcn5

SCOPe Domain Sequences for d5tpxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tpxa1 a.29.2.0 (A:1356-1460) automated matches {Plasmodium falciparum [TaxId: 36329]}
hkevqlkdqilgvldylekqqsawpflkpvslseapdyydiikeptdiltmrrkarhgdy
ktkedfgielkrmfdncrlynapttiyfkyanelqtliwpkyeai

SCOPe Domain Coordinates for d5tpxa1:

Click to download the PDB-style file with coordinates for d5tpxa1.
(The format of our PDB-style files is described here.)

Timeline for d5tpxa1:

  • d5tpxa1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-04

View in 3D
Domains from same chain:
(mouse over for more information)
d5tpxa2