Lineage for d5t6sl_ (5t6s L:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3041799Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 3041800Protein automated matches [254645] (42 species)
    not a true protein
  7. 3041984Species Influenza A virus [TaxId:1332244] [327811] (5 PDB entries)
  8. 3041990Domain d5t6sl_: 5t6s L: [327825]
    Other proteins in same PDB: d5t6sa_, d5t6sc_, d5t6se_, d5t6sg_, d5t6si_, d5t6sk_
    automated match to d4kdmb_
    complexed with 75u, na, nag

Details for d5t6sl_

PDB Entry: 5t6s (more details), 2.36 Å

PDB Description: crystal structure of the a/shanghai/2/2013 (h7n9) influenza virus hemagglutinin in complex with the antiviral drug arbidol
PDB Compounds: (L:) hemagglutinin HA2

SCOPe Domain Sequences for d5t6sl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6sl_ h.3.1.0 (L:) automated matches {Influenza A virus [TaxId: 1332244]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri

SCOPe Domain Coordinates for d5t6sl_:

Click to download the PDB-style file with coordinates for d5t6sl_.
(The format of our PDB-style files is described here.)

Timeline for d5t6sl_: