SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ws7b_ (5ws7 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189565Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2189566Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2189567Family d.113.1.1: MutT-like [55812] (17 protein domains)
  6. 2189568Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (1 species)
  7. 2189569Species Human (Homo sapiens) [TaxId:9606] [103208] (20 PDB entries)
  8. 2284520Domain d5ws7b_: 5ws7 B: [327821]
    automated match to d1irya_
    protein/DNA complex; complexed with 6u4, na; mutant

Details for d5ws7b_

PDB Entry: 5ws7 (more details), 1 Å

PDB Description: crystal structure of human mth1(g2k/c87a/c104s mutant) in complex with 2-oxo-datp
PDB Compounds: (B:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d5ws7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws7b_ d.113.1.1 (B:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
mkasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
vdalhkvgqivfefvgepelmdvhvfatdsiqgtpvesdemrpswfqldqipfkdmwpdd
sywfplllqkkkfhgyfkfqgqdtildytlrevdtv

SCOPe Domain Coordinates for d5ws7b_:

Click to download the PDB-style file with coordinates for d5ws7b_.
(The format of our PDB-style files is described here.)

Timeline for d5ws7b_:

  • d5ws7b_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-04