Lineage for d5t6sf_ (5t6s F:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2239599Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2239600Protein automated matches [254645] (22 species)
    not a true protein
  7. 2284510Species Influenza a virus [TaxId:1332244] [327811] (4 PDB entries)
  8. 2284519Domain d5t6sf_: 5t6s F: [327820]
    Other proteins in same PDB: d5t6sa_, d5t6sc_, d5t6se_, d5t6sg_, d5t6si_, d5t6sk_
    automated match to d4kdmb_
    complexed with 75u, bma, na, nag

Details for d5t6sf_

PDB Entry: 5t6s (more details), 2.36 Å

PDB Description: crystal structure of the a/shanghai/2/2013 (h7n9) influenza virus hemagglutinin in complex with the antiviral drug arbidol
PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d5t6sf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6sf_ h.3.1.0 (F:) automated matches {Influenza a virus [TaxId: 1332244]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnri

SCOPe Domain Coordinates for d5t6sf_:

Click to download the PDB-style file with coordinates for d5t6sf_.
(The format of our PDB-style files is described here.)

Timeline for d5t6sf_:

  • d5t6sf_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-04