Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries) |
Domain d5h2ud1: 5h2u D:185-446 [327801] Other proteins in same PDB: d5h2ua2, d5h2ua3, d5h2ub2, d5h2ub3, d5h2uc2, d5h2uc3, d5h2ud2, d5h2ud3 automated match to d3clya_ complexed with 1n1, gol |
PDB Entry: 5h2u (more details), 2.24 Å
SCOPe Domain Sequences for d5h2ud1:
Sequence, based on SEQRES records: (download)
>d5h2ud1 d.144.1.0 (D:185-446) automated matches {Human (Homo sapiens) [TaxId: 9606]} erpreeftlcrklgsgyfgevfeglwkdrvqvaikvisrdnllhqqmlqseiqamkklrh khilalyavvsvgdpvyiitelmakgsllellrdsdekvlpvselldiawqvaegmcyle sqnyihrdlaarnilvgentlckvgdfglarlikedvylshdhnipykwtapealsrghy stksdvwsfgillhemfsrgqvpypgmsnheaflrvdagyrmpcplecppsvhklmltcw crdpeqrptfkalrerlssfts
>d5h2ud1 d.144.1.0 (D:185-446) automated matches {Human (Homo sapiens) [TaxId: 9606]} erpreeftlcrklgsgyfgevfeglwkdrvqvaikvisrdnllhqqmlqseiqamkklrh khilalyavvsvgdpvyiitelmakgsllellrsdekvlpvselldiawqvaegmcyles qnyihrdlaarnilvgentlckvgdfglarlikedvylshdhnipykwtapealsrghys tksdvwsfgillhemfsrgqvpypgmsnheaflrvdagyrmpcplecppsvhklmltcwc rdpeqrptfkalrerlssfts
Timeline for d5h2ud1: