SCOPe 2.06: Domain d5gx2a_: 5gx2 A:

Lineage for d5gx2a_ (5gx2 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families)

5. Family b.68.6.0: automated matches [277246] (1 protein)
   not a true family

6. Protein automated matches [277247] (1 species)
   not a true protein

7. Species Firefly (Photinus pyralis) [TaxId:7054] [277248] (10 PDB entries)

8. Domain d5gx2a_: 5gx2 A: [327796]
   automated match to d5d9ba_
   complexed with gol, hg, mg, mpd

Details for d5gx2a_

PDB Entry: 5gx2, 1.6 Å

PDB Description: luciferin-regenerating enzyme collected with serial synchrotron rotational crystallography with accumulated dose of 3.4 mgy (3rd measurement)

PDB Compounds: (A:) Luciferin regenerating enzyme

SCOPe Domain Sequences for d5gx2a_:

Sequence; same for both SEQRES and ATOM records:

>d5gx2a_ b.68.6.0 (A:) automated matches {Firefly (Photinus pyralis) [TaxId: 7054]}
gpvvekiaelgkytvgegphwdhetqtlyfvdtvektfhkyvpsqkkytfckvdklvsfi
iplagspgrfvvslereiailtwdgvsaaptsieaivnvephiknnrlndgkadplgnlw
tgtmaidaglpigpvtgslyhlgadkkvkmhesniaianglawsndlkkmyyidsgkrrv
deydydastlsisnqrplftfekhevpgypdgqtideegnlwvavfqgqriikistqqpe
vlldtvkipdpqvtsvafggpnldelyvtsaglqlddssfdkslvnghvyrvtglgvkgf
agvkvkl

Timeline for d5gx2a_:

• d5gx2a_ is new in SCOPe 2.06-stable
  
• d5gx2a_ appears in SCOPe 2.07
  
• d5gx2a_ appears in the current release, SCOPe 2.08