Lineage for d5b6ca2 (5b6c A:107-191)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2166602Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2166603Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2166604Family d.31.1.1: Cdc48 domain 2-like [54586] (4 protein domains)
  6. 2166619Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species)
  7. 2166620Species Human (Homo sapiens) [TaxId:9606] [233318] (11 PDB entries)
  8. 2284488Domain d5b6ca2: 5b6c A:107-191 [327789]
    Other proteins in same PDB: d5b6ca1, d5b6ca3, d5b6ca4
    automated match to d1e32a3

Details for d5b6ca2

PDB Entry: 5b6c (more details), 1.55 Å

PDB Description: structural details of ufd1 binding to p97
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5b6ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b6ca2 d.31.1.1 (A:107-191) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikr

SCOPe Domain Coordinates for d5b6ca2:

Click to download the PDB-style file with coordinates for d5b6ca2.
(The format of our PDB-style files is described here.)

Timeline for d5b6ca2:

  • d5b6ca2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-04