SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b6ca2 (5b6c A:107-191)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2166602Fold d.31: Cdc48 domain 2-like [54584] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2166603Superfamily d.31.1: Cdc48 domain 2-like [54585] (2 families) (S)
  5. 2166604Family d.31.1.1: Cdc48 domain 2-like [54586] (4 protein domains)
  6. 2166619Protein Membrane fusion atpase p97 domain 2, P97-Nc [64254] (2 species)
  7. 2166620Species Human (Homo sapiens) [TaxId:9606] [233318] (11 PDB entries)
  8. 2284488Domain d5b6ca2: 5b6c A:107-191 [327789]
    Other proteins in same PDB: d5b6ca1, d5b6ca3, d5b6ca4
    automated match to d1e32a3

Details for d5b6ca2

PDB Entry: 5b6c (more details), 1.55 Å

PDB Description: structural details of ufd1 binding to p97
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5b6ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b6ca2 d.31.1.1 (A:107-191) Membrane fusion atpase p97 domain 2, P97-Nc {Human (Homo sapiens) [TaxId: 9606]}
dvkygkrihvlpiddtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvv
etdpspycivapdtvihcegepikr

SCOPe Domain Coordinates for d5b6ca2:

Click to download the PDB-style file with coordinates for d5b6ca2.
(The format of our PDB-style files is described here.)

Timeline for d5b6ca2:

  • d5b6ca2 appears in periodic updates to SCOPe 2.06 starting on 2017-01-04