Lineage for d5b6ca1 (5b6c A:21-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061141Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2061195Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2061340Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 protein domains)
  6. 2061341Protein Membrane fusion ATPase p97 N-terminal domain , P97-Nn [63796] (2 species)
  7. 2061342Species Human (Homo sapiens) [TaxId:9606] [233316] (11 PDB entries)
  8. 2284486Domain d5b6ca1: 5b6c A:21-106 [327787]
    Other proteins in same PDB: d5b6ca2, d5b6ca3, d5b6ca4
    automated match to d4kdia1

Details for d5b6ca1

PDB Entry: 5b6c (more details), 1.55 Å

PDB Description: structural details of ufd1 binding to p97
PDB Compounds: (A:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d5b6ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b6ca1 b.52.2.3 (A:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Human (Homo sapiens) [TaxId: 9606]}
nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
kirmnrvvrnnlrvrlgdvisiqpcp

SCOPe Domain Coordinates for d5b6ca1:

Click to download the PDB-style file with coordinates for d5b6ca1.
(The format of our PDB-style files is described here.)

Timeline for d5b6ca1:

  • d5b6ca1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-04