Lineage for d5tist_ (5tis T:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254847Superfamily f.23.34: Photosystem II reaction center protein T, PsbT [161029] (1 family) (S)
    automatically mapped to Pfam PF01405
  5. 2254848Family f.23.34.1: PsbT-like [161030] (1 protein)
    Pfam PF01405
  6. 2254849Protein Photosystem II reaction center protein T, PsbT [161031] (3 species)
  7. 2254850Species Thermosynechococcus elongatus [TaxId:146786] [161032] (7 PDB entries)
    Uniprot Q8DIQ0 1-30
  8. 2254851Domain d5tist_: 5tis T: [327784]
    Other proteins in same PDB: d5tisa_, d5tisb_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tiso_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
    automated match to d3bz2t_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tist_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (T:) Photosystem II reaction center protein T

SCOPe Domain Sequences for d5tist_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tist_ f.23.34.1 (T:) Photosystem II reaction center protein T, PsbT {Thermosynechococcus elongatus [TaxId: 146786]}
metityvfifaciialfffaiffrepprit

SCOPe Domain Coordinates for d5tist_:

Click to download the PDB-style file with coordinates for d5tist_.
(The format of our PDB-style files is described here.)

Timeline for d5tist_: