SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jyld1 (5jyl D:1-118)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (562 PDB entries)
  8. 2284481Domain d5jyld1: 5jyl D:1-118 [327782]
    Other proteins in same PDB: d5jyla_, d5jylc_
    automated match to d1f3rb1
    complexed with cl, gol, po4

Details for d5jyld1

PDB Entry: 5jyl (more details), 2.55 Å

PDB Description: human p-cadherin mec1 with scfv tsp7 bound
PDB Compounds: (D:) scFv TSP7

SCOPe Domain Sequences for d5jyld1:

Sequence, based on SEQRES records: (download)

>d5jyld1 b.1.1.0 (D:1-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlqesgpelvkpgasvkmsckasgysftaynmhwvkqshgkslewigfidpysgiity
nqtfkgkatltvdkssstaymqlnsltsedsavyycarrgyydggfdywgqgttltvs

Sequence, based on observed residues (ATOM records): (download)

>d5jyld1 b.1.1.0 (D:1-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlqesgpelvkpgasvkmsckasgysftaynmhwvkqshkslewigfidpysgiityn
qtfkgkatltvdkssstaymqlnsltsedsavyycarrgyydggfdywgqgttltvs

SCOPe Domain Coordinates for d5jyld1:

Click to download the PDB-style file with coordinates for d5jyld1.
(The format of our PDB-style files is described here.)

Timeline for d5jyld1:

  • d5jyld1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-30