Lineage for d5kaiu_ (5kai u:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329531Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329766Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 2329793Protein automated matches [191005] (3 species)
    not a true protein
  7. 2329794Species Thermosynechococcus elongatus [TaxId:197221] [260559] (5 PDB entries)
  8. 2329798Domain d5kaiu_: 5kai u: [327777]
    Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kail_, d5kaim1, d5kaim2, d5kaio_, d5kait1, d5kait2, d5kaiv_, d5kaix_, d5kaiz_
    automated match to d2axtu1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaiu_

PDB Entry: 5kai (more details), 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
PDB Compounds: (u:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5kaiu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaiu_ a.60.12.2 (u:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d5kaiu_:

Click to download the PDB-style file with coordinates for d5kaiu_.
(The format of our PDB-style files is described here.)

Timeline for d5kaiu_: