Lineage for d5tish_ (5tis H:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631822Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) (S)
    automatically mapped to Pfam PF00737
  5. 2631823Family f.23.33.1: PsbH-like [161026] (2 proteins)
    Pfam PF00737
  6. 2631855Protein automated matches [191001] (5 species)
    not a true protein
  7. 2631860Species Thermosynechococcus elongatus [TaxId:197221] [327761] (3 PDB entries)
  8. 2631861Domain d5tish_: 5tis H: [327774]
    Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tise_, d5tisf_, d5tisi_, d5tisj_, d5tisk_, d5tisl_, d5tism_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
    automated match to d2axth1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tish_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (H:) Photosystem II reaction center protein H

SCOPe Domain Sequences for d5tish_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tish_ f.23.33.1 (H:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wkalg

SCOPe Domain Coordinates for d5tish_:

Click to download the PDB-style file with coordinates for d5tish_.
(The format of our PDB-style files is described here.)

Timeline for d5tish_: