Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) automatically mapped to Pfam PF00421 |
Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
Protein automated matches [191285] (3 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [260540] (4 PDB entries) |
Domain d5kafc_: 5kaf C: [327773] Other proteins in same PDB: d5kafa_, d5kafd_, d5kafe_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_ automated match to d4pj0c_ complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5kaf (more details), 3 Å
SCOPe Domain Sequences for d5kafc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kafc_ f.55.1.1 (C:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} atnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmy eqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetlee yssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnp tldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarr afiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdq klganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikn diqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghl whagraraaaagfekgidresepvlsmpsld
Timeline for d5kafc_: