SCOPe 2.07: Domain d5kafk_: 5kaf k:

Lineage for d5kafk_ (5kaf k:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families)
   automatically mapped to Pfam PF02533

5. Family f.23.36.0: automated matches [327289] (1 protein)
   not a true family

6. Protein automated matches [327290] (1 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [327291] (4 PDB entries)

8. Domain d5kafk_: 5kaf k: [327771]
   Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kaff_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafl_, d5kafm1, d5kafm2, d5kafo_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
   automated match to d2axtk1
   complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafk_

PDB Entry: 5kaf, 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution

PDB Compounds: (k:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d5kafk_:

Sequence; same for both SEQRES and ATOM records:

>d5kafk_ f.23.36.0 (k:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

Timeline for d5kafk_:

• d5kafk_ first appeared in SCOPe 2.06
  
• d5kafk_ appears in the current release, SCOPe 2.08