Lineage for d5kafk_ (5kaf k:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254892Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 2254914Family f.23.36.0: automated matches [327289] (1 protein)
    not a true family
  6. 2254915Protein automated matches [327290] (1 species)
    not a true protein
  7. 2254916Species Thermosynechococcus elongatus [TaxId:197221] [327291] (4 PDB entries)
  8. 2254920Domain d5kafk_: 5kaf k: [327771]
    Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
    automated match to d2axtk1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafk_

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (k:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d5kafk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kafk_ f.23.36.0 (k:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d5kafk_:

Click to download the PDB-style file with coordinates for d5kafk_.
(The format of our PDB-style files is described here.)

Timeline for d5kafk_: