Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) automatically mapped to Pfam PF02533 |
Family f.23.36.0: automated matches [327289] (1 protein) not a true family |
Protein automated matches [327290] (1 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [327291] (4 PDB entries) |
Domain d5kafk_: 5kaf k: [327771] Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_ automated match to d2axtk1 complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5kaf (more details), 3 Å
SCOPe Domain Sequences for d5kafk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kafk_ f.23.36.0 (k:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} klpeayaifdplvdvlpvipvlflalafvwqaavgfr
Timeline for d5kafk_: