Lineage for d5kafx_ (5kaf X:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2255005Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 2255006Family f.23.40.1: PsbX-like [267615] (2 proteins)
  6. 2255010Protein automated matches [267680] (2 species)
    not a true protein
  7. 2255011Species Thermosynechococcus elongatus [TaxId:197221] [311275] (7 PDB entries)
  8. 2255016Domain d5kafx_: 5kaf X: [327767]
    Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafz_
    automated match to d4il6x_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafx_

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (X:) Photosystem II reaction center X protein

SCOPe Domain Sequences for d5kafx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kafx_ f.23.40.1 (X:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
titpslkgffigllsgavvlgltfavliaisqidkvqr

SCOPe Domain Coordinates for d5kafx_:

Click to download the PDB-style file with coordinates for d5kafx_.
(The format of our PDB-style files is described here.)

Timeline for d5kafx_: