Lineage for d5kafe_ (5kaf E:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254945Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2254946Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2254970Protein automated matches [191000] (4 species)
    not a true protein
  7. 2254974Species Thermosynechococcus elongatus [TaxId:197221] [326602] (5 PDB entries)
  8. 2254981Domain d5kafe_: 5kaf E: [327763]
    Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_, d5kafz_
    automated match to d2axte1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafe_

PDB Entry: 5kaf (more details), 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
PDB Compounds: (E:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d5kafe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kafe_ f.23.38.1 (E:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
ttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsi
plvtdrfeakqqvetfleqlk

SCOPe Domain Coordinates for d5kafe_:

Click to download the PDB-style file with coordinates for d5kafe_.
(The format of our PDB-style files is described here.)

Timeline for d5kafe_: