SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tkdb_ (5tkd B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (778 PDB entries)
  8. 2284459Domain d5tkdb_: 5tkd B: [327760]
    automated match to d4l00b_
    complexed with 7gl, so4

Details for d5tkdb_

PDB Entry: 5tkd (more details), 1.92 Å

PDB Description: crystal structure of tyrosine kinase 2 jh2 (pseudo kinase domain) complexed with 6-[(3,5-dimethylphe nyl)amino]-8- (methylamino) imidazo[1,2-b]pyridazine-3-carbo xamide
PDB Compounds: (B:) Non-receptor tyrosine-protein kinase TYK2

SCOPe Domain Sequences for d5tkdb_:

Sequence, based on SEQRES records: (download)

>d5tkdb_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhrvdqkeitqlshlgqgtrtnvyegrlrvegsgdpeegkmddedplvpgrdrgqelrvv
lkvldpshhdialafyetaslmsqvshthlafvhgvcvrgpenimvteyvehgpldvwlr
rerghvpmawkmvvaqqlasalsylenknlvhgnvcgrnillarlglaegtspfiklsdp
gvglgalsreerveripwlapeclpgganslstamdkwgfgatlleicfdgeaplqsrsp
sekehfyqrqhrlpepscpqlatltsqcltyeptqrpsfrtilrdlt

Sequence, based on observed residues (ATOM records): (download)

>d5tkdb_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhrvdqkeitqlshlgqgtrtnvyegrlrelrvvlkvldpshhdialafyetaslmsqvs
hthlafvhgvcvrgpenimvteyvehgpldvwlrrerghvpmawkmvvaqqlasalsyle
nknlvhgnvcgrnillarlglaspfiklsdpgvglgalsreerveripwlapeclpstam
dkwgfgatlleicfdgeaplrspsekehfyqrqhrlpepslatltsqcltyeptqrpsfr
tilrdlt

SCOPe Domain Coordinates for d5tkdb_:

Click to download the PDB-style file with coordinates for d5tkdb_.
(The format of our PDB-style files is described here.)

Timeline for d5tkdb_:

  • d5tkdb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-30