Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) Pfam PF06596 |
Family f.23.40.1: PsbX-like [267615] (2 proteins) |
Protein automated matches [267680] (2 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [311275] (7 PDB entries) |
Domain d5tisx_: 5tis X: [327756] Other proteins in same PDB: d5tisa_, d5tisb_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisz_ automated match to d4il6x_ complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5tis (more details), 2.25 Å
SCOPe Domain Sequences for d5tisx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tisx_ f.23.40.1 (X:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} titpslkgffigllsgavvlgltfavliaisqidkvqr
Timeline for d5tisx_: