Lineage for d5tisx_ (5tis X:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2255005Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 2255006Family f.23.40.1: PsbX-like [267615] (2 proteins)
  6. 2255010Protein automated matches [267680] (2 species)
    not a true protein
  7. 2255011Species Thermosynechococcus elongatus [TaxId:197221] [311275] (7 PDB entries)
  8. 2255013Domain d5tisx_: 5tis X: [327756]
    Other proteins in same PDB: d5tisa_, d5tisb_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisz_
    automated match to d4il6x_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisx_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (X:) Photosystem II reaction center X protein

SCOPe Domain Sequences for d5tisx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tisx_ f.23.40.1 (X:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
titpslkgffigllsgavvlgltfavliaisqidkvqr

SCOPe Domain Coordinates for d5tisx_:

Click to download the PDB-style file with coordinates for d5tisx_.
(The format of our PDB-style files is described here.)

Timeline for d5tisx_: