Lineage for d5kaij_ (5kai J:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631774Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) (S)
    automatically mapped to Pfam PF01788
  5. 2631775Family f.23.32.1: PsbJ-like [161022] (2 proteins)
    Pfam PF01788
  6. 2631785Protein automated matches [191002] (3 species)
    not a true protein
  7. 2631786Species Thermosynechococcus elongatus [TaxId:197221] [327287] (3 PDB entries)
  8. 2631788Domain d5kaij_: 5kai J: [327750]
    Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaik_, d5kail_, d5kaim1, d5kaim2, d5kaio_, d5kait1, d5kait2, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_
    automated match to d4ub8j_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaij_

PDB Entry: 5kai (more details), 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
PDB Compounds: (J:) Photosystem II reaction center protein J

SCOPe Domain Sequences for d5kaij_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaij_ f.23.32.1 (J:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
ggriplwivatvagmgvivivglffygayaglgssl

SCOPe Domain Coordinates for d5kaij_:

Click to download the PDB-style file with coordinates for d5kaij_.
(The format of our PDB-style files is described here.)

Timeline for d5kaij_: