Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
Protein automated matches [190453] (22 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:197221] [327705] (4 PDB entries) |
Domain d5kafv_: 5kaf v: [327747] Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kaft1, d5kaft2, d5kafu_, d5kafx_, d5kafz_ automated match to d1e29a_ complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5kaf (more details), 3 Å
SCOPe Domain Sequences for d5kafv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kafv_ a.3.1.0 (v:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]} aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil vepkilgdkwgggkvyy
Timeline for d5kafv_: