SCOPe 2.07: Domain d5kafz_: 5kaf Z:

Lineage for d5kafz_ (5kaf Z:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.5: PsbZ-like [161055] (2 families)
   automatically mapped to Pfam PF01737

5. Family f.17.5.1: PsbZ-like [161056] (1 protein)
   Pfam PF01737; Ycf9

6. Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161058] (9 PDB entries)
   Uniprot Q8DHJ2 1-62

8. Domain d5kafz_: 5kaf Z: [327743]
   Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kaff_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kafl_, d5kafm1, d5kafm2, d5kafo_, d5kaft1, d5kaft2, d5kafu_, d5kafv_, d5kafx_
   automated match to d4pj0z_
   complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafz_

PDB Entry: 5kaf, 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution

PDB Compounds: (Z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d5kafz_:

Sequence; same for both SEQRES and ATOM records:

>d5kafz_ f.17.5.1 (Z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus elongatus [TaxId: 146786]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

Timeline for d5kafz_:

• d5kafz_ first appeared in SCOPe 2.06
  
• d5kafz_ appears in the current release, SCOPe 2.08