SCOPe 2.08: Domain d5ingc1: 5ing C:14-263

Lineage for d5ingc1 (5ing C:14-263)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (71 species)
   not a true protein

7. Species Streptomyces ambofaciens [TaxId:278992] [327583] (3 PDB entries)

8. Domain d5ingc1: 5ing C:14-263 [327732]
   automated match to d3iava1

Details for d5ingc1

PDB Entry: 5ing, 2.45 Å

PDB Description: a crotonyl-coa reductase-carboxylase independent pathway for assembly of unusual alkylmalonyl-coa polyketide synthase extender unit

PDB Compounds: (C:) Putative carboxyl transferase

SCOPe Domain Sequences for d5ingc1:

Sequence; same for both SEQRES and ATOM records:

>d5ingc1 c.14.1.0 (C:14-263) automated matches {Streptomyces ambofaciens [TaxId: 278992]}
ptstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrh
rtveagiprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvg
cpvigindsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltd
ftvmvkdisymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvq
tllgylppnn

Timeline for d5ingc1:

• d5ingc1 first appeared in SCOPe 2.06
  
• d5ingc1 appears in SCOPe 2.07