Lineage for d1b4qa_ (1b4q A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24117Family c.47.1.1: Thioltransferase [52834] (2 proteins)
  6. 24118Protein Glutaredoxin (Thioltransferase) [52843] (5 species)
  7. 24133Species Human (Homo sapiens) [TaxId:9606] [52848] (2 PDB entries)
  8. 24135Domain d1b4qa_: 1b4q A: [32773]

Details for d1b4qa_

PDB Entry: 1b4q (more details)

PDB Description: solution structure of human thioltransferase complex with glutathione

SCOP Domain Sequences for d1b4qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4qa_ c.47.1.1 (A:) Glutaredoxin (Thioltransferase) {Human (Homo sapiens)}
aqefvnskiqpgkvvvfikptcpysrraqeilsqlpikqgllefvditatnhtneiqdyl
qqltgartvprvfigkdsiggssdlvslqqsgelltrlkqigalq

SCOP Domain Coordinates for d1b4qa_:

Click to download the PDB-style file with coordinates for d1b4qa_.
(The format of our PDB-style files is described here.)

Timeline for d1b4qa_: