Lineage for d5tiso_ (5tis O:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627486Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2627487Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 2627529Family f.4.1.4: PsbO-like [161115] (2 proteins)
    Pfam PF01716; MSP
  6. 2627561Protein automated matches [191004] (2 species)
    not a true protein
  7. 2627562Species Thermosynechococcus elongatus [TaxId:197221] [260553] (5 PDB entries)
  8. 2627563Domain d5tiso_: 5tis O: [327729]
    Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tisj_, d5tisk_, d5tisl_, d5tism_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
    automated match to d4il6o_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tiso_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d5tiso_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tiso_ f.4.1.4 (O:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
qtltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqe
aefvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftv
knlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeel
aranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyas
iepa

SCOPe Domain Coordinates for d5tiso_:

Click to download the PDB-style file with coordinates for d5tiso_.
(The format of our PDB-style files is described here.)

Timeline for d5tiso_: