Lineage for d5u7sa1 (5u7s A:1-345)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2284419Species Acinetobacter baumannii [TaxId:470] [327720] (1 PDB entry)
  8. 2284420Domain d5u7sa1: 5u7s A:1-345 [327721]
    Other proteins in same PDB: d5u7sa2, d5u7sb2
    automated match to d3gaya_
    complexed with cit, fmt, na

Details for d5u7sa1

PDB Entry: 5u7s (more details), 2.5 Å

PDB Description: crystal structure of a fructose-bisphosphate aldolase, class ii, calvin cycle subtype from acinetobacter baumannii
PDB Compounds: (A:) fructose-1,6-bisphosphate aldolase

SCOPe Domain Sequences for d5u7sa1:

Sequence, based on SEQRES records: (download)

>d5u7sa1 c.1.10.0 (A:1-345) automated matches {Acinetobacter baumannii [TaxId: 470]}
malismrqlldhaaehnygvpafnvnnleqmraimlaadatnspvivqasagarkyagap
flrhlilaaieewphipvvmhqdhgtspdvcqrsiqlgfssvmmdgslgadgktpttydy
nvdvtrqvvamahacgvsvegeigclgsletgmageedgvgaegvldhsqlltsveeakq
fvadtnvdalaiavgtshgaykftrpptgdilaidrikeihaalpnthlvmhgsssvpqe
wlkvinefggnigetygvpveqlveaikhgvrkinidtdlrlastgairrfmaenpaefd
prkyfaktvdsmkqicidryeafgtagnadkirpislekmvdryk

Sequence, based on observed residues (ATOM records): (download)

>d5u7sa1 c.1.10.0 (A:1-345) automated matches {Acinetobacter baumannii [TaxId: 470]}
malismrqlldhaaehnygvpafnvnnleqmraimlaadatnspvivqasagapflrhli
laaieewphipvvmhqdhgtspdvcqrsiqlgfssvmmdgslgadgktpttydynvdvtr
qvvamahacgvsvegeigclgsletvldhsqlltsveeakqfvadtnvdalaiavgtshg
aykftrpptgdilaidrikeihaalpnthlvmhgsssvpqewlkvinefggnigetygvp
veqlveaikhgvrkinidtdlrlastgairrfmaenpaefdprkyfaktvdsmkqicidr
yeafgtagnadkirpislekmvdryk

SCOPe Domain Coordinates for d5u7sa1:

Click to download the PDB-style file with coordinates for d5u7sa1.
(The format of our PDB-style files is described here.)

Timeline for d5u7sa1:

  • d5u7sa1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29

View in 3D
Domains from same chain:
(mouse over for more information)
d5u7sa2