SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u7sa1 (5u7s A:1-345)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (73 species)
    not a true protein
  7. 2284419Species Acinetobacter baumannii [TaxId:470] [327720] (1 PDB entry)
  8. 2284420Domain d5u7sa1: 5u7s A:1-345 [327721]
    Other proteins in same PDB: d5u7sa2, d5u7sb2
    automated match to d3gaya_
    complexed with cit, fmt, na

Details for d5u7sa1

PDB Entry: 5u7s (more details), 2.5 Å

PDB Description: crystal structure of a fructose-bisphosphate aldolase, class ii, calvin cycle subtype from acinetobacter baumannii
PDB Compounds: (A:) fructose-1,6-bisphosphate aldolase

SCOPe Domain Sequences for d5u7sa1:

Sequence, based on SEQRES records: (download)

>d5u7sa1 c.1.10.0 (A:1-345) automated matches {Acinetobacter baumannii [TaxId: 470]}
malismrqlldhaaehnygvpafnvnnleqmraimlaadatnspvivqasagarkyagap
flrhlilaaieewphipvvmhqdhgtspdvcqrsiqlgfssvmmdgslgadgktpttydy
nvdvtrqvvamahacgvsvegeigclgsletgmageedgvgaegvldhsqlltsveeakq
fvadtnvdalaiavgtshgaykftrpptgdilaidrikeihaalpnthlvmhgsssvpqe
wlkvinefggnigetygvpveqlveaikhgvrkinidtdlrlastgairrfmaenpaefd
prkyfaktvdsmkqicidryeafgtagnadkirpislekmvdryk

Sequence, based on observed residues (ATOM records): (download)

>d5u7sa1 c.1.10.0 (A:1-345) automated matches {Acinetobacter baumannii [TaxId: 470]}
malismrqlldhaaehnygvpafnvnnleqmraimlaadatnspvivqasagapflrhli
laaieewphipvvmhqdhgtspdvcqrsiqlgfssvmmdgslgadgktpttydynvdvtr
qvvamahacgvsvegeigclgsletvldhsqlltsveeakqfvadtnvdalaiavgtshg
aykftrpptgdilaidrikeihaalpnthlvmhgsssvpqewlkvinefggnigetygvp
veqlveaikhgvrkinidtdlrlastgairrfmaenpaefdprkyfaktvdsmkqicidr
yeafgtagnadkirpislekmvdryk

SCOPe Domain Coordinates for d5u7sa1:

Click to download the PDB-style file with coordinates for d5u7sa1.
(The format of our PDB-style files is described here.)

Timeline for d5u7sa1:

  • d5u7sa1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29

View in 3D
Domains from same chain:
(mouse over for more information)
d5u7sa2