Lineage for d5sz6a_ (5sz6 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2067966Family b.74.1.1: Carbonic anhydrase [51070] (2 protein domains)
    automatically mapped to Pfam PF00194
  6. 2067967Protein Carbonic anhydrase [51071] (10 species)
  7. 2068005Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (675 PDB entries)
    Uniprot P00918
  8. 2284412Domain d5sz6a_: 5sz6 A: [327713]
    automated match to d4r5aa_
    complexed with 72g, dms, gol, zn

Details for d5sz6a_

PDB Entry: 5sz6 (more details), 1.15 Å

PDB Description: carbonic anhydrase ix-mimic in complex with 4-(3-formylphenyl)- benzenesulfonamide
PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d5sz6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sz6a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
lpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk

SCOPe Domain Coordinates for d5sz6a_:

Click to download the PDB-style file with coordinates for d5sz6a_.
(The format of our PDB-style files is described here.)

Timeline for d5sz6a_:

  • d5sz6a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29