SCOPe 2.07: Domain d5tisu_: 5tis U:

Lineage for d5tisu_ (5tis U:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.2: PsbU-like [158539] (2 proteins)
   Pfam PF06514

6. Protein automated matches [191005] (3 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [260559] (5 PDB entries)

8. Domain d5tisu_: 5tis U: [327712]
   Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tisj_, d5tisk_, d5tisl_, d5tism_, d5tiso_, d5tist_, d5tisv_, d5tisx_, d5tisz_
   automated match to d2axtu1
   complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisu_

PDB Entry: 5tis, 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex

PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5tisu_:

Sequence; same for both SEQRES and ATOM records:

>d5tisu_ a.60.12.2 (U:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

Timeline for d5tisu_:

• d5tisu_ first appeared in SCOPe 2.06
  
• d5tisu_ appears in the current release, SCOPe 2.08