Lineage for d5tisu_ (5tis U:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329531Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329766Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 2329793Protein automated matches [191005] (3 species)
    not a true protein
  7. 2329794Species Thermosynechococcus elongatus [TaxId:197221] [260559] (5 PDB entries)
  8. 2329795Domain d5tisu_: 5tis U: [327712]
    Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tise_, d5tisf_, d5tish_, d5tisi_, d5tisj_, d5tisk_, d5tisl_, d5tism_, d5tiso_, d5tist_, d5tisv_, d5tisx_, d5tisz_
    automated match to d2axtu1
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5tisu_

PDB Entry: 5tis (more details), 2.25 Å

PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5tisu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tisu_ a.60.12.2 (U:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d5tisu_:

Click to download the PDB-style file with coordinates for d5tisu_.
(The format of our PDB-style files is described here.)

Timeline for d5tisu_: