Class a: All alpha proteins [46456] (289 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.10: Stathmin [101494] (1 family) single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
Family a.137.10.1: Stathmin [101495] (2 proteins) |
Protein Stathmin 4 [101496] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (72 PDB entries) |
Domain d5kx5e_: 5kx5 E: [327711] Other proteins in same PDB: d5kx5b1, d5kx5b2, d5kx5c1, d5kx5c2, d5kx5d1, d5kx5d2, d5kx5f1, d5kx5f2, d5kx5f3 automated match to d4i55e_ complexed with 6yk, adp, ca, gdp, gtp, mg |
PDB Entry: 5kx5 (more details), 2.5 Å
SCOPe Domain Sequences for d5kx5e_:
Sequence, based on SEQRES records: (download)
>d5kx5e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelke
>d5kx5e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkatsgqswevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk e
Timeline for d5kx5e_: