SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t52a_ (5t52 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (51 species)
    not a true protein
  7. 2284393Species Bauhinia forficata [TaxId:413686] [327694] (4 PDB entries)
  8. 2284402Domain d5t52a_: 5t52 A: [327703]
    automated match to d1hqla_
    complexed with a2g, ca, edo, nga

Details for d5t52a_

PDB Entry: 5t52 (more details), 1.7 Å

PDB Description: lectin from bauhinia forficata in complex with galnac
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d5t52a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t52a_ b.29.1.0 (A:) automated matches {Bauhinia forficata [TaxId: 413686]}
selsfnypnfqsveditfqggasprnetlqltptdsngipirqraghavysqpfqlrdts
fyttftfvirttsnspadgfaifiappdfpvkryggylglfepntatntsankvvavefd
twvntewkepryrhigidvnsivsvrvtrwqdkdvfsrsiatahvgydgiskiltafvty
pdggnyvlshvvdlaeifpgdvrigfsgatgqyetqyihswsfsststn

SCOPe Domain Coordinates for d5t52a_:

Click to download the PDB-style file with coordinates for d5t52a_.
(The format of our PDB-style files is described here.)

Timeline for d5t52a_:

  • d5t52a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29