SCOPe 2.08: Domain d5t52a_: 5t52 A:

Lineage for d5t52a_ (5t52 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Bauhinia forficata [TaxId:413686] [327694] (4 PDB entries)

8. Domain d5t52a_: 5t52 A: [327703]
   automated match to d1hqla_
   complexed with a2g, ca, edo, nga

Details for d5t52a_

PDB Entry: 5t52, 1.7 Å

PDB Description: lectin from bauhinia forficata in complex with galnac

PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d5t52a_:

Sequence; same for both SEQRES and ATOM records:

>d5t52a_ b.29.1.0 (A:) automated matches {Bauhinia forficata [TaxId: 413686]}
selsfnypnfqsveditfqggasprnetlqltptdsngipirqraghavysqpfqlrdts
fyttftfvirttsnspadgfaifiappdfpvkryggylglfepntatntsankvvavefd
twvntewkepryrhigidvnsivsvrvtrwqdkdvfsrsiatahvgydgiskiltafvty
pdggnyvlshvvdlaeifpgdvrigfsgatgqyetqyihswsfsststn

Timeline for d5t52a_:

• d5t52a_ first appeared in SCOPe 2.06
  
• d5t52a_ appears in SCOPe 2.07