Lineage for d5t1dl1 (5t1d L:1-112)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020203Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)
  8. 2284399Domain d5t1dl1: 5t1d L:1-112 [327700]
    Other proteins in same PDB: d5t1dl2
    automated match to d1t66c1
    complexed with nag

Details for d5t1dl1

PDB Entry: 5t1d (more details), 3.1 Å

PDB Description: crystal structure of ebv ghgl/gp42/e1d1 complex
PDB Compounds: (L:) E1D1 IgG2a light chain

SCOPe Domain Sequences for d5t1dl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t1dl1 b.1.1.1 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divitqtplslpvslgdqasiscrssqsllhsngntylhwylqrpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlminrveaedlgvyfcsqsihvprtfgggtkleik

SCOPe Domain Coordinates for d5t1dl1:

Click to download the PDB-style file with coordinates for d5t1dl1.
(The format of our PDB-style files is described here.)

Timeline for d5t1dl1:

  • d5t1dl1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29