Lineage for d5sy9a_ (5sy9 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2104318Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2104490Family c.23.16.2: DJ-1/PfpI [52325] (10 protein domains)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2104491Protein DJ-1 [89603] (1 species)
    RNA-binding protein regulatory subunit
  7. 2104492Species Human (Homo sapiens) [TaxId:9606] [89604] (45 PDB entries)
    Uniprot Q99497
  8. 2284398Domain d5sy9a_: 5sy9 A: [327699]
    automated match to d4s0za_
    complexed with edo; mutant

Details for d5sy9a_

PDB Entry: 5sy9 (more details), 1.1 Å

PDB Description: atomic resolution structure of e15q mutant human dj-1
PDB Compounds: (A:) Protein deglycase DJ-1

SCOPe Domain Sequences for d5sy9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sy9a_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
maskralvilakgaqemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasled
akkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfg
skvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaq
vkaplvlk

SCOPe Domain Coordinates for d5sy9a_:

Click to download the PDB-style file with coordinates for d5sy9a_.
(The format of our PDB-style files is described here.)

Timeline for d5sy9a_:

  • d5sy9a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29