SCOPe 2.06: Domain d5sz5a_: 5sz5 A:

Lineage for d5sz5a_ (5sz5 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (682 PDB entries)
   Uniprot P00918

8. Domain d5sz5a_: 5sz5 A: [327698]
   automated match to d4r5aa_
   complexed with 72e, dms, zn

Details for d5sz5a_

PDB Entry: 5sz5, 1.27 Å

PDB Description: carbonic anhydrase ix-mimic in complex with 4-(2-methylphenyl)- benzenesulfonamide

PDB Compounds: (A:) Carbonic anhydrase 2

SCOPe Domain Sequences for d5sz5a_:

Sequence; same for both SEQRES and ATOM records:

>d5sz5a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hsfqvtfddsqdkavlkggpldgtyrllqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktegksadftnfdprgl
lpesldywtypgslttpplaecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk

Timeline for d5sz5a_:

• d5sz5a_ is new in SCOPe 2.06-stable
  
• d5sz5a_ appears in SCOPe 2.07
  
• d5sz5a_ appears in the current release, SCOPe 2.08