Lineage for d5sy4b_ (5sy4 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2104318Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2104490Family c.23.16.2: DJ-1/PfpI [52325] (10 protein domains)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2104608Protein automated matches [190995] (8 species)
    not a true protein
  7. 2284387Species Escherichia coli [TaxId:562] [327688] (1 PDB entry)
  8. 2284395Domain d5sy4b_: 5sy4 B: [327696]
    automated match to d2ab0a1
    complexed with mg

Details for d5sy4b_

PDB Entry: 5sy4 (more details), 0.98 Å

PDB Description: atomic resolution structure of reduced e. coli yajl
PDB Compounds: (B:) Chaperone YajL

SCOPe Domain Sequences for d5sy4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sy4b_ c.23.16.2 (B:) automated matches {Escherichia coli [TaxId: 562]}
sasalvclapgseeteavttidllvrggikvttasvasdgnlaitcsrgvklladaplve
vadgeydvivlpggikgaecfrdstllvetvkqfhrsgrivaaicaapatvlvphdifpi
gnmtgfptlkdkipaeqwldkrvvwdarvklltsqgpgtaidfglkiidllvgrekahev
asqlvmaagiynyye

SCOPe Domain Coordinates for d5sy4b_:

Click to download the PDB-style file with coordinates for d5sy4b_.
(The format of our PDB-style files is described here.)

Timeline for d5sy4b_:

  • d5sy4b_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29