SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5sy6a1 (5sy6 A:4-188)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2104318Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2104490Family c.23.16.2: DJ-1/PfpI [52325] (10 protein domains)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2104491Protein DJ-1 [89603] (1 species)
    RNA-binding protein regulatory subunit
  7. 2104492Species Human (Homo sapiens) [TaxId:9606] [89604] (45 PDB entries)
    Uniprot Q99497
  8. 2284391Domain d5sy6a1: 5sy6 A:4-188 [327692]
    Other proteins in same PDB: d5sy6a2
    automated match to d4s0za_
    complexed with dtt

Details for d5sy6a1

PDB Entry: 5sy6 (more details), 1.15 Å

PDB Description: atomic resolution structure of human dj-1, dtt bound
PDB Compounds: (A:) Protein deglycase DJ-1

SCOPe Domain Sequences for d5sy6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sy6a1 c.23.16.2 (A:4-188) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
kralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasledakk
egpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgskv
tthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqvka
plvlk

SCOPe Domain Coordinates for d5sy6a1:

Click to download the PDB-style file with coordinates for d5sy6a1.
(The format of our PDB-style files is described here.)

Timeline for d5sy6a1:

  • d5sy6a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29

View in 3D
Domains from same chain:
(mouse over for more information)
d5sy6a2