SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mi0c2 (5mi0 C:112-217)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (466 PDB entries)
  8. 2284390Domain d5mi0c2: 5mi0 C:112-217 [327691]
    Other proteins in same PDB: d5mi0c1
    automated match to d1tqbc2

Details for d5mi0c2

PDB Entry: 5mi0 (more details), 2.35 Å

PDB Description: a thermally stabilised version of plasmodium falciparum rh5
PDB Compounds: (C:) monoclonal antibody 9ad4

SCOPe Domain Sequences for d5mi0c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mi0c2 b.1.1.2 (C:112-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d5mi0c2:

Click to download the PDB-style file with coordinates for d5mi0c2.
(The format of our PDB-style files is described here.)

Timeline for d5mi0c2:

  • d5mi0c2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29