SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mi0c1 (5mi0 C:1-111)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (25 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (535 PDB entries)
  8. 2284389Domain d5mi0c1: 5mi0 C:1-111 [327690]
    Other proteins in same PDB: d5mi0c2
    automated match to d1a5fl1

Details for d5mi0c1

PDB Entry: 5mi0 (more details), 2.35 Å

PDB Description: a thermally stabilised version of plasmodium falciparum rh5
PDB Compounds: (C:) monoclonal antibody 9ad4

SCOPe Domain Sequences for d5mi0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mi0c1 b.1.1.0 (C:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratiscrasesveyygtslmqwfqqkpgqpprllihgasnvqs
gvparfsgsgsgtdfslnihpveeddfamyfcqqstkvpwtfgggtkleik

SCOPe Domain Coordinates for d5mi0c1:

Click to download the PDB-style file with coordinates for d5mi0c1.
(The format of our PDB-style files is described here.)

Timeline for d5mi0c1:

  • d5mi0c1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29