Lineage for d5mi0c1 (5mi0 C:1-111)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (563 PDB entries)
  8. 2284389Domain d5mi0c1: 5mi0 C:1-111 [327690]
    Other proteins in same PDB: d5mi0c2
    automated match to d1a5fl1

Details for d5mi0c1

PDB Entry: 5mi0 (more details), 2.35 Å

PDB Description: a thermally stabilised version of plasmodium falciparum rh5
PDB Compounds: (C:) monoclonal antibody 9ad4

SCOPe Domain Sequences for d5mi0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mi0c1 b.1.1.0 (C:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratiscrasesveyygtslmqwfqqkpgqpprllihgasnvqs
gvparfsgsgsgtdfslnihpveeddfamyfcqqstkvpwtfgggtkleik

SCOPe Domain Coordinates for d5mi0c1:

Click to download the PDB-style file with coordinates for d5mi0c1.
(The format of our PDB-style files is described here.)

Timeline for d5mi0c1:

  • d5mi0c1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29