SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5sy4a_ (5sy4 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2104318Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2104490Family c.23.16.2: DJ-1/PfpI [52325] (10 protein domains)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2104608Protein automated matches [190995] (7 species)
    not a true protein
  7. 2284387Species Escherichia coli [TaxId:562] [327688] (1 PDB entry)
  8. 2284388Domain d5sy4a_: 5sy4 A: [327689]
    automated match to d2ab0a1
    complexed with mg

Details for d5sy4a_

PDB Entry: 5sy4 (more details), 0.98 Å

PDB Description: atomic resolution structure of reduced e. coli yajl
PDB Compounds: (A:) Chaperone YajL

SCOPe Domain Sequences for d5sy4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sy4a_ c.23.16.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
sasalvclapgseeteavttidllvrggikvttasvasdgnlaitcsrgvklladaplve
vadgeydvivlpggikgaecfrdstllvetvkqfhrsgrivaaicaapatvlvphdifpi
gnmtgfptlkdkipaeqwldkrvvwdarvklltsqgpgtaidfglkiidllvgrekahev
asqlvmaagiynyye

SCOPe Domain Coordinates for d5sy4a_:

Click to download the PDB-style file with coordinates for d5sy4a_.
(The format of our PDB-style files is described here.)

Timeline for d5sy4a_:

  • d5sy4a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29