SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2n9la1 (2n9l A:3-57)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2160552Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2160553Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 protein domains)
  6. 2160578Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species)
  7. 2160591Species Streptococcus sp., group G [TaxId:1306] [54361] (35 PDB entries)
  8. 2284379Domain d2n9la1: 2n9l A:3-57 [327680]
    Other proteins in same PDB: d2n9la2
    automated match to d1fd6a_

Details for d2n9la1

PDB Entry: 2n9l (more details)

PDB Description: 1h, 13c, and 15n chemical shift assignments for in-cell gb1
PDB Compounds: (A:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d2n9la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n9la1 d.15.7.1 (A:3-57) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
tyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte

SCOPe Domain Coordinates for d2n9la1:

Click to download the PDB-style file with coordinates for d2n9la1.
(The format of our PDB-style files is described here.)

Timeline for d2n9la1:

  • d2n9la1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29

View in 3D
Domains from same chain:
(mouse over for more information)
d2n9la2