Lineage for d2n9la1 (2n9l A:3-57)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503865Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2503866Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 protein domains)
  6. 2503891Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)
  7. 2503918Species Streptococcus sp., group G [TaxId:1306] [54361] (36 PDB entries)
  8. 2503956Domain d2n9la1: 2n9l A:3-57 [327680]
    Other proteins in same PDB: d2n9la2
    automated match to d1fd6a_

Details for d2n9la1

PDB Entry: 2n9l (more details)

PDB Description: 1h, 13c, and 15n chemical shift assignments for in-cell gb1
PDB Compounds: (A:) Immunoglobulin G-binding protein G

SCOPe Domain Sequences for d2n9la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n9la1 d.15.7.1 (A:3-57) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
tyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte

SCOPe Domain Coordinates for d2n9la1:

Click to download the PDB-style file with coordinates for d2n9la1.
(The format of our PDB-style files is described here.)

Timeline for d2n9la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2n9la2