SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mpod_ (5mpo D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2168779Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2169144Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) (S)
  5. 2169158Family d.41.5.0: automated matches [191646] (1 protein)
    not a true family
  6. 2169159Protein automated matches [191185] (4 species)
    not a true protein
  7. 2169163Species Human (Homo sapiens) [TaxId:9606] [194767] (2 PDB entries)
  8. 2284378Domain d5mpod_: 5mpo D: [327679]
    automated match to d4ap8a_

Details for d5mpod_

PDB Entry: 5mpo (more details), 2.43 Å

PDB Description: crystal structure of human molybdopterin synthase complex
PDB Compounds: (D:) Molybdopterin synthase catalytic subunit

SCOPe Domain Sequences for d5mpod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mpod_ d.41.5.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekskdvinftaeklsvdevsqlvisplcgaislfvgttrnnfegkkvisleyeaylpmae
nevrkicsdirqkwpvkhiavfhrlglvpvseasiiiavssahraasleavsyaidtlka
kvpiwkkeiye

SCOPe Domain Coordinates for d5mpod_:

Click to download the PDB-style file with coordinates for d5mpod_.
(The format of our PDB-style files is described here.)

Timeline for d5mpod_:

  • d5mpod_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29

View in 3D
Domains from other chains:
(mouse over for more information)
d5mpoc_