Lineage for d5mpod_ (5mpo D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2168779Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2169144Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) (S)
  5. 2169158Family d.41.5.0: automated matches [191646] (1 protein)
    not a true family
  6. 2169159Protein automated matches [191185] (4 species)
    not a true protein
  7. 2169163Species Human (Homo sapiens) [TaxId:9606] [194767] (2 PDB entries)
  8. 2284378Domain d5mpod_: 5mpo D: [327679]
    automated match to d4ap8a_

Details for d5mpod_

PDB Entry: 5mpo (more details), 2.43 Å

PDB Description: crystal structure of human molybdopterin synthase complex
PDB Compounds: (D:) Molybdopterin synthase catalytic subunit

SCOPe Domain Sequences for d5mpod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mpod_ d.41.5.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ekskdvinftaeklsvdevsqlvisplcgaislfvgttrnnfegkkvisleyeaylpmae
nevrkicsdirqkwpvkhiavfhrlglvpvseasiiiavssahraasleavsyaidtlka
kvpiwkkeiye

SCOPe Domain Coordinates for d5mpod_:

Click to download the PDB-style file with coordinates for d5mpod_.
(The format of our PDB-style files is described here.)

Timeline for d5mpod_:

  • d5mpod_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29

View in 3D
Domains from other chains:
(mouse over for more information)
d5mpoc_