SCOPe 2.08: Domain d5mpoc_: 5mpo C:

Lineage for d5mpoc_ (5mpo C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families)

5. Family d.41.5.0: automated matches [191646] (1 protein)
   not a true family

6. Protein automated matches [191185] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [194767] (2 PDB entries)

8. Domain d5mpoc_: 5mpo C: [327678]
   automated match to d4ap8a_

Details for d5mpoc_

PDB Entry: 5mpo, 2.43 Å

PDB Description: crystal structure of human molybdopterin synthase complex

PDB Compounds: (C:) Molybdopterin synthase catalytic subunit

SCOPe Domain Sequences for d5mpoc_:

Sequence; same for both SEQRES and ATOM records:

>d5mpoc_ d.41.5.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eekskdvinftaeklsvdevsqlvisplcgaislfvgttrnnfegkkvisleyeaylpma
enevrkicsdirqkwpvkhiavfhrlglvpvseasiiiavssahraasleavsyaidtlk
akvpiwkkeiye

Timeline for d5mpoc_:

• d5mpoc_ first appeared in SCOPe 2.06
  
• d5mpoc_ appears in SCOPe 2.07