SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lxeb_ (5lxe B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089162Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2089216Family c.1.16.0: automated matches [191510] (1 protein)
    not a true family
  6. 2089217Protein automated matches [190849] (7 species)
    not a true protein
  7. 2284351Species Rhodococcus jostii [TaxId:101510] [327652] (1 PDB entry)
  8. 2284376Domain d5lxeb_: 5lxe B: [327677]
    automated match to d1rhca_
    complexed with gol, so4

Details for d5lxeb_

PDB Entry: 5lxe (more details), 1.47 Å

PDB Description: f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1
PDB Compounds: (B:) F420-dependent glucose-6-phosphate dehydrogenase 1

SCOPe Domain Sequences for d5lxeb_:

Sequence, based on SEQRES records: (download)

>d5lxeb_ c.1.16.0 (B:) automated matches {Rhodococcus jostii [TaxId: 101510]}
mvikfgykasaeqfgprelvelgvlaeahgmdsatvsdhfqpwrhegghapfslawmtav
gertsrlqlgtsvmtptfrynpavvaqafatmgclypgrimlgvgtgealneiatgfage
wpefkerfarlreavalmrelwlgdrvdfegnyyktvgasiydvpeggipvyiaaggpvv
aryagrsgdgfictsgkgmelyteklmpavaegaekadrdvaeidkmieikisydtdpel
alentrfwaplsltpeqkhsiddpiemeraadalpieqvakrwivasdpdeavaqirpyl
daglnhlvfhapghdqkrflelfqrdlaprlrgl

Sequence, based on observed residues (ATOM records): (download)

>d5lxeb_ c.1.16.0 (B:) automated matches {Rhodococcus jostii [TaxId: 101510]}
mvikfgykasaeqfgprelvelgvlaeahgmdsatvsdhfqpwrhegghapfslawmtav
gertsrlqlgtsvmtptfrynpavvaqafatmgclypgrimlgvgtgealneiatgfage
wpefkerfarlreavalmrelwlgdrvdfegnyyktvgasiydvpeggipvyiaaggpvv
aryagrsgdgfictsgkgmelyteklmpavaegaekadrdvaeidkmieikisydtdpel
alentrfwaakrwivasdpdeavaqirpyldaglnhlvfhapghdqkrflelfqrdlapr
lrgl

SCOPe Domain Coordinates for d5lxeb_:

Click to download the PDB-style file with coordinates for d5lxeb_.
(The format of our PDB-style files is described here.)

Timeline for d5lxeb_:

  • d5lxeb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29