![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
![]() | Protein automated matches [190246] (57 species) not a true protein |
![]() | Species Streptomyces ambofaciens [TaxId:278992] [327583] (3 PDB entries) |
![]() | Domain d5inia1: 5ini A:15-263 [327675] automated match to d3iava1 complexed with hxc |
PDB Entry: 5ini (more details), 2.85 Å
SCOPe Domain Sequences for d5inia1:
Sequence, based on SEQRES records: (download)
>d5inia1 c.14.1.0 (A:15-263) automated matches {Streptomyces ambofaciens [TaxId: 278992]} tstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhr tveagiprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgc pvigindsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdf tvmvkdisymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvqt llgylppnn
>d5inia1 c.14.1.0 (A:15-263) automated matches {Streptomyces ambofaciens [TaxId: 278992]} tstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhr tprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpvigi ndsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftvmvk disymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllgyl ppnn
Timeline for d5inia1: