Lineage for d5ingf1 (5ing F:15-263)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (53 species)
    not a true protein
  7. 2284282Species Streptomyces ambofaciens [TaxId:278992] [327583] (3 PDB entries)
  8. 2284366Domain d5ingf1: 5ing F:15-263 [327667]
    automated match to d3iava1

Details for d5ingf1

PDB Entry: 5ing (more details), 2.45 Å

PDB Description: a crotonyl-coa reductase-carboxylase independent pathway for assembly of unusual alkylmalonyl-coa polyketide synthase extender unit
PDB Compounds: (F:) Putative carboxyl transferase

SCOPe Domain Sequences for d5ingf1:

Sequence, based on SEQRES records: (download)

>d5ingf1 c.14.1.0 (F:15-263) automated matches {Streptomyces ambofaciens [TaxId: 278992]}
tstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhr
tveagiprpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgc
pvigindsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdf
tvmvkdisymfvtgpevvsavmgeqvtaeqlggpavhaevsgnahyvgddeqdaiswvqt
llgylppnn

Sequence, based on observed residues (ATOM records): (download)

>d5ingf1 c.14.1.0 (F:15-263) automated matches {Streptomyces ambofaciens [TaxId: 278992]}
tstadriadlaarheeavvlaekkaadrqhlkgkltararidllldpgsfveldefvrhr
prpygdgvvtghgtidgrqvcvfshdfttlggsmgeafgskvvkiydfamsvgcpvigin
dsggariqegvmsiayytelgvrnvhssgvipqislimgpcaggsvyspaltdftvmvkd
isymfvtgpevvsavmqvtaeqlggpavhaevsgnahyvgddeqdaiswvqtllgylppn
n

SCOPe Domain Coordinates for d5ingf1:

Click to download the PDB-style file with coordinates for d5ingf1.
(The format of our PDB-style files is described here.)

Timeline for d5ingf1:

  • d5ingf1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29