Lineage for d5m5ba_ (5m5b A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145865Family c.66.1.25: mRNA cap methylase [88785] (3 proteins)
  6. 2145910Protein automated matches [190302] (8 species)
    not a true protein
  7. 2145954Species Zika virus [TaxId:64320] [322811] (2 PDB entries)
  8. 2145956Domain d5m5ba_: 5m5b A: [327661]
    automated match to d2px8b_
    complexed with cl, gol, sam, so4

Details for d5m5ba_

PDB Entry: 5m5b (more details), 2.01 Å

PDB Description: crystal structure of zika virus ns5 methyltransferase
PDB Compounds: (A:) NS5 methyltransferase

SCOPe Domain Sequences for d5m5ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m5ba_ c.66.1.25 (A:) automated matches {Zika virus [TaxId: 64320]}
etlgekwkarlnqmsalefysykksgitevcreearralkdgvatgghavsrgsaklrwl
vergylqpygkvidlgcgrggwsyyaatirkvqevkgytkggpgheepmlvqsygwnivr
lksgvdvfhmaaepcdtllcdigesssspeveeartlrvlsmvgdwlekrpgafcikvlc
pytstmmetlerlqrryggglvrvplsrnsthemywvsgaksntiksvsttsqlllgrmd
gprrpvkyeedvnlgsgtrav

SCOPe Domain Coordinates for d5m5ba_:

Click to download the PDB-style file with coordinates for d5m5ba_.
(The format of our PDB-style files is described here.)

Timeline for d5m5ba_: