SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m5ba_ (5m5b A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129933Family c.66.1.25: mRNA cap methylase [88785] (3 protein domains)
  6. 2129978Protein automated matches [190302] (8 species)
    not a true protein
  7. 2279510Species Zika virus [TaxId:64320] [322811] (2 PDB entries)
  8. 2284360Domain d5m5ba_: 5m5b A: [327661]
    automated match to d2px8b_
    complexed with cl, gol, sam, so4

Details for d5m5ba_

PDB Entry: 5m5b (more details), 2.01 Å

PDB Description: crystal structure of zika virus ns5 methyltransferase
PDB Compounds: (A:) NS5 methyltransferase

SCOPe Domain Sequences for d5m5ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m5ba_ c.66.1.25 (A:) automated matches {Zika virus [TaxId: 64320]}
etlgekwkarlnqmsalefysykksgitevcreearralkdgvatgghavsrgsaklrwl
vergylqpygkvidlgcgrggwsyyaatirkvqevkgytkggpgheepmlvqsygwnivr
lksgvdvfhmaaepcdtllcdigesssspeveeartlrvlsmvgdwlekrpgafcikvlc
pytstmmetlerlqrryggglvrvplsrnsthemywvsgaksntiksvsttsqlllgrmd
gprrpvkyeedvnlgsgtrav

SCOPe Domain Coordinates for d5m5ba_:

Click to download the PDB-style file with coordinates for d5m5ba_.
(The format of our PDB-style files is described here.)

Timeline for d5m5ba_:

  • d5m5ba_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-29