Lineage for d5kmoa1 (5kmo A:500-796)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (865 PDB entries)
  8. 2284358Domain d5kmoa1: 5kmo A:500-796 [327659]
    Other proteins in same PDB: d5kmoa2
    automated match to d4foca_
    complexed with 6um

Details for d5kmoa1

PDB Entry: 5kmo (more details), 2.67 Å

PDB Description: trka jm-kinase with 1-(2-methyl-4-phenyl-pyrimidin-5-yl)-3-(2- pyridyl)urea
PDB Compounds: (A:) high affinity nerve growth factor receptor

SCOPe Domain Sequences for d5kmoa1:

Sequence, based on SEQRES records: (download)

>d5kmoa1 d.144.1.0 (A:500-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acvhhikrrdivlkwelgegafgkvflaechnllpeqdkmlvavkalkeasesarqdfqr
eaelltmlqhqhivrffgvctegrpllmvfeymrhgdlnrflrshgpdakllaggedvap
gplglgqllavasqvaagmvylaglhfvhrdlatrnclvgqglvvkigdfgmsrdiystd
yyrvggrtmlpirwmppesilyrkfttesdvwsfgvvlweiftygkqpwyqlsnteaidc
itqgrelerpracppevyaimrgcwqrepqqrhsikdvharlqalaqappvyldvlg

Sequence, based on observed residues (ATOM records): (download)

>d5kmoa1 d.144.1.0 (A:500-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acvhhikrrdivlkwelgegafgkvflaechnllpeqdkmlvavkalkesarqdfqreae
lltmlqhqhivrffgvctegrpllmvfeymrhgdlnrflrshgpdaklggedvapgplgl
gqllavasqvaagmvylaglhfvhrdlatrnclvgqglvvkigdfgrdiystdyyrvggr
tmlpirwmppesilyrkfttesdvwsfgvvlweiftygkqpwyqlsnteaidcitqgrel
erpracppevyaimrgcwqrepqqrhsikdvharlqalaqappvyldvlg

SCOPe Domain Coordinates for d5kmoa1:

Click to download the PDB-style file with coordinates for d5kmoa1.
(The format of our PDB-style files is described here.)

Timeline for d5kmoa1:

  • d5kmoa1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29

View in 3D
Domains from same chain:
(mouse over for more information)
d5kmoa2