SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gzna2 (5gzn A:304-407)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2033030Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2033031Protein automated matches [190226] (50 species)
    not a true protein
  7. 2273979Species Zika virus [TaxId:64320] [317280] (5 PDB entries)
  8. 2284357Domain d5gzna2: 5gzn A:304-407 [327658]
    Other proteins in same PDB: d5gzna1, d5gznb1, d5gznd1, d5gznd2, d5gznl1, d5gznl2
    automated match to d4gsxa2

Details for d5gzna2

PDB Entry: 5gzn (more details), 3 Å

PDB Description: structure of neutralizing antibody bound to zika envelope protein
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d5gzna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gzna2 b.1.18.0 (A:304-407) automated matches {Zika virus [TaxId: 64320]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrsgsti

SCOPe Domain Coordinates for d5gzna2:

Click to download the PDB-style file with coordinates for d5gzna2.
(The format of our PDB-style files is described here.)

Timeline for d5gzna2:

  • d5gzna2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-29